![]() | Class b: All beta proteins [48724] (111 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
![]() | Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) ![]() |
![]() | Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins) |
![]() | Protein beta-Galactosidase, domains 2 and 4 [49305] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [49306] (23 PDB entries) |
![]() | Domain d1jz1n1: 1jz1 N:220-333 [67695] Other proteins in same PDB: d1jz1i3, d1jz1i4, d1jz1i5, d1jz1j3, d1jz1j4, d1jz1j5, d1jz1k3, d1jz1k4, d1jz1k5, d1jz1l3, d1jz1l4, d1jz1l5, d1jz1m3, d1jz1m4, d1jz1m5, d1jz1n3, d1jz1n4, d1jz1n5, d1jz1o3, d1jz1o4, d1jz1o5, d1jz1p3, d1jz1p4, d1jz1p5 |
PDB Entry: 1jz1 (more details), 2.6 Å
SCOP Domain Sequences for d1jz1n1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jz1n1 b.1.4.1 (N:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli} tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr
Timeline for d1jz1n1:
![]() Domains from same chain: (mouse over for more information) d1jz1n2, d1jz1n3, d1jz1n4, d1jz1n5 |
![]() Domains from other chains: (mouse over for more information) d1jz1i1, d1jz1i2, d1jz1i3, d1jz1i4, d1jz1i5, d1jz1j1, d1jz1j2, d1jz1j3, d1jz1j4, d1jz1j5, d1jz1k1, d1jz1k2, d1jz1k3, d1jz1k4, d1jz1k5, d1jz1l1, d1jz1l2, d1jz1l3, d1jz1l4, d1jz1l5, d1jz1m1, d1jz1m2, d1jz1m3, d1jz1m4, d1jz1m5, d1jz1o1, d1jz1o2, d1jz1o3, d1jz1o4, d1jz1o5, d1jz1p1, d1jz1p2, d1jz1p3, d1jz1p4, d1jz1p5 |