Lineage for d1jyyf1 (1jyy F:220-333)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 366897Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) (S)
  5. 366898Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins)
  6. 366899Protein beta-Galactosidase, domains 2 and 4 [49305] (1 species)
  7. 366900Species Escherichia coli [TaxId:562] [49306] (23 PDB entries)
  8. 367055Domain d1jyyf1: 1jyy F:220-333 [67575]
    Other proteins in same PDB: d1jyya3, d1jyya4, d1jyya5, d1jyyb3, d1jyyb4, d1jyyb5, d1jyyc3, d1jyyc4, d1jyyc5, d1jyyd3, d1jyyd4, d1jyyd5, d1jyye3, d1jyye4, d1jyye5, d1jyyf3, d1jyyf4, d1jyyf5, d1jyyg3, d1jyyg4, d1jyyg5, d1jyyh3, d1jyyh4, d1jyyh5

Details for d1jyyf1

PDB Entry: 1jyy (more details), 2.7 Å

PDB Description: e. coli (lacz) beta-galactosidase in complex with 2-f-lactose. chains a-h, see remark 400.

SCOP Domain Sequences for d1jyyf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jyyf1 b.1.4.1 (F:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

SCOP Domain Coordinates for d1jyyf1:

Click to download the PDB-style file with coordinates for d1jyyf1.
(The format of our PDB-style files is described here.)

Timeline for d1jyyf1: