Lineage for d1jyvd5 (1jyv D:334-625)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1339265Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1339836Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 1339920Protein beta-Galactosidase, domain 3 [51510] (2 species)
  7. 1339928Species Escherichia coli [TaxId:562] [51511] (25 PDB entries)
    Uniprot P00722
  8. 1339972Domain d1jyvd5: 1jyv D:334-625 [67509]
    Other proteins in same PDB: d1jyva1, d1jyva2, d1jyva3, d1jyva4, d1jyvb1, d1jyvb2, d1jyvb3, d1jyvb4, d1jyvc1, d1jyvc2, d1jyvc3, d1jyvc4, d1jyvd1, d1jyvd2, d1jyvd3, d1jyvd4
    complexed with 145, dms, mg, na

Details for d1jyvd5

PDB Entry: 1jyv (more details), 1.75 Å

PDB Description: e. coli (lacz) beta-galactosidase (e537q) in complex with onpg
PDB Compounds: (D:) beta-galactosidase

SCOPe Domain Sequences for d1jyvd5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jyvd5 c.1.8.3 (D:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilcqyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d1jyvd5:

Click to download the PDB-style file with coordinates for d1jyvd5.
(The format of our PDB-style files is described here.)

Timeline for d1jyvd5: