Lineage for d1jyvd3 (1jyv D:13-219)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1304969Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1304970Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 1305080Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins)
  6. 1305081Protein beta-Galactosidase [49804] (2 species)
  7. 1305089Species Escherichia coli [TaxId:562] [49805] (25 PDB entries)
    Uniprot P00722
  8. 1305133Domain d1jyvd3: 1jyv D:13-219 [67507]
    Other proteins in same PDB: d1jyva1, d1jyva2, d1jyva4, d1jyva5, d1jyvb1, d1jyvb2, d1jyvb4, d1jyvb5, d1jyvc1, d1jyvc2, d1jyvc4, d1jyvc5, d1jyvd1, d1jyvd2, d1jyvd4, d1jyvd5
    complexed with 145, dms, mg, na

Details for d1jyvd3

PDB Entry: 1jyv (more details), 1.75 Å

PDB Description: e. coli (lacz) beta-galactosidase (e537q) in complex with onpg
PDB Compounds: (D:) beta-galactosidase

SCOPe Domain Sequences for d1jyvd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jyvd3 b.18.1.5 (D:13-219) beta-Galactosidase {Escherichia coli [TaxId: 562]}
rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
dgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d1jyvd3:

Click to download the PDB-style file with coordinates for d1jyvd3.
(The format of our PDB-style files is described here.)

Timeline for d1jyvd3: