Lineage for d1jyvc1 (1jyv C:220-333)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 936216Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) (S)
  5. 936217Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 936218Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species)
  7. 936232Species Escherichia coli [TaxId:562] [49306] (25 PDB entries)
    Uniprot P00722
  8. 936317Domain d1jyvc1: 1jyv C:220-333 [67500]
    Other proteins in same PDB: d1jyva3, d1jyva4, d1jyva5, d1jyvb3, d1jyvb4, d1jyvb5, d1jyvc3, d1jyvc4, d1jyvc5, d1jyvd3, d1jyvd4, d1jyvd5
    complexed with 145, dms, mg, na

Details for d1jyvc1

PDB Entry: 1jyv (more details), 1.75 Å

PDB Description: e. coli (lacz) beta-galactosidase (e537q) in complex with onpg
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d1jyvc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jyvc1 b.1.4.1 (C:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

SCOPe Domain Coordinates for d1jyvc1:

Click to download the PDB-style file with coordinates for d1jyvc1.
(The format of our PDB-style files is described here.)

Timeline for d1jyvc1: