Lineage for d1jyva4 (1jyv A:731-1023)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 109071Fold b.30: Supersandwich [49993] (4 superfamilies)
  4. 109072Superfamily b.30.1: beta-Galactosidase, domain 5 [49994] (1 family) (S)
  5. 109073Family b.30.1.1: beta-Galactosidase, domain 5 [49995] (1 protein)
  6. 109074Protein beta-Galactosidase, domain 5 [49996] (1 species)
  7. 109075Species Escherichia coli [TaxId:562] [49997] (23 PDB entries)
  8. 109104Domain d1jyva4: 1jyv A:731-1023 [67493]
    Other proteins in same PDB: d1jyva1, d1jyva2, d1jyva3, d1jyva5, d1jyvb1, d1jyvb2, d1jyvb3, d1jyvb5, d1jyvc1, d1jyvc2, d1jyvc3, d1jyvc5, d1jyvd1, d1jyvd2, d1jyvd3, d1jyvd5

Details for d1jyva4

PDB Entry: 1jyv (more details), 1.75 Å

PDB Description: e. coli (lacz) beta-galactosidase (e537q) in complex with onpg

SCOP Domain Sequences for d1jyva4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jyva4 b.30.1.1 (A:731-1023) beta-Galactosidase, domain 5 {Escherichia coli}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOP Domain Coordinates for d1jyva4:

Click to download the PDB-style file with coordinates for d1jyva4.
(The format of our PDB-style files is described here.)

Timeline for d1jyva4: