Lineage for d1jyka1 (1jyk A:7-231)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2149496Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2149497Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2150158Family c.68.1.13: Cytidylytransferase [68901] (7 proteins)
  6. 2150234Protein CTP:phosphocholine cytidylytransferase LicC [69569] (1 species)
  7. 2150235Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [69570] (2 PDB entries)
  8. 2150236Domain d1jyka1: 1jyk A:7-231 [67458]
    Other proteins in same PDB: d1jyka2

Details for d1jyka1

PDB Entry: 1jyk (more details), 1.5 Å

PDB Description: Catalytic Mechanism of CTP:phosphocholine Cytidylytransferase from Streptococcus pneumoniae (LicC)
PDB Compounds: (A:) CTP:phosphocholine Cytidylytransferase

SCOPe Domain Sequences for d1jyka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jyka1 c.68.1.13 (A:7-231) CTP:phosphocholine cytidylytransferase LicC {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
kaiilaaglgtrlrpltentpkalvqvnqkplieyqieflkekgindiiiivgylkeqfd
ylkekygvrlvfndkyadynnfyslylvkeelansyvidadnylfknmfrndltrstyfs
vyredctnewflvygddykvqdiivdskagrilsgvsfwdaptaekivsfidkayvsgef
vdlywdnmvkdnikeldvyveelegnsiyeidsvqdyrkleeilk

SCOPe Domain Coordinates for d1jyka1:

Click to download the PDB-style file with coordinates for d1jyka1.
(The format of our PDB-style files is described here.)

Timeline for d1jyka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jyka2