Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) |
Family c.68.1.13: Cytidylytransferase [68901] (7 proteins) |
Protein CTP:phosphocholine cytidylytransferase LicC [69569] (1 species) |
Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [69570] (2 PDB entries) |
Domain d1jyka1: 1jyk A:7-231 [67458] Other proteins in same PDB: d1jyka2 |
PDB Entry: 1jyk (more details), 1.5 Å
SCOPe Domain Sequences for d1jyka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jyka1 c.68.1.13 (A:7-231) CTP:phosphocholine cytidylytransferase LicC {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} kaiilaaglgtrlrpltentpkalvqvnqkplieyqieflkekgindiiiivgylkeqfd ylkekygvrlvfndkyadynnfyslylvkeelansyvidadnylfknmfrndltrstyfs vyredctnewflvygddykvqdiivdskagrilsgvsfwdaptaekivsfidkayvsgef vdlywdnmvkdnikeldvyveelegnsiyeidsvqdyrkleeilk
Timeline for d1jyka1: