Lineage for d1jv2a1 (1jv2 A:439-598)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 105981Superfamily b.1.15: Integrin domains [69179] (1 family) (S)
  5. 105982Family b.1.15.1: Integrin domains [69180] (2 proteins)
  6. 105986Protein Thigh, calf-1 and calf-2 domains of integrin alpha [69181] (1 species)
  7. 105987Species Human (Homo sapiens) [TaxId:9606] [69182] (1 PDB entry)
  8. 105988Domain d1jv2a1: 1jv2 A:439-598 [67334]
    Other proteins in same PDB: d1jv2a4, d1jv2b1, d1jv2b2, d1jv2b3, d1jv2b4, d1jv2b5

Details for d1jv2a1

PDB Entry: 1jv2 (more details), 3.1 Å

PDB Description: crystal structure of the extracellular segment of integrin alphavbeta3

SCOP Domain Sequences for d1jv2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jv2a1 b.1.15.1 (A:439-598) Thigh, calf-1 and calf-2 domains of integrin alpha {Human (Homo sapiens)}
pvitvnaglevypsilnqdnktcslpgtalkvscfnvrfclkadgkgvlprklnfqvell
ldklkqkgairralflysrspshsknmtisrgglmqceeliaylrdesefrdkltpitif
meyrldyrtaadttglqpilnqftpanisrqahilldcge

SCOP Domain Coordinates for d1jv2a1:

Click to download the PDB-style file with coordinates for d1jv2a1.
(The format of our PDB-style files is described here.)

Timeline for d1jv2a1: