SCOPe 2.06: Domain d1juqb1: 1juq B:1-157

Lineage for d1juqb1 (1juq B:1-157)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.9: ENTH/VHS domain [48464] (5 families)

5. Family a.118.9.2: VHS domain [48468] (6 proteins)

6. Protein ADP-ribosylation factor binding protein Gga3 [69097] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69098] (3 PDB entries)

8. Domain d1juqb1: 1juq B:1-157 [67323]
   Other proteins in same PDB: d1juqb2, d1juqd2
   complexed with peptide from cation-dependent mannose 6-phosphate receptor

Details for d1juqb1

PDB Entry: 1juq, 2.2 Å

PDB Description: gga3 vhs domain complexed with c-terminal peptide from cation- dependent mannose 6-phosphate receptor

PDB Compounds: (B:) ADP-ribosylation factor binding protein gga3

SCOPe Domain Sequences for d1juqb1:

Sequence; same for both SEQRES and ATOM records:

>d1juqb1 a.118.9.2 (B:1-157) ADP-ribosylation factor binding protein Gga3 {Human (Homo sapiens) [TaxId: 9606]}
maeaegesleswlnkatnpsnrqedweyiigfcdqinkelegpqiavrllahkiqspqew
ealqaltvleacmkncgrrfhnevgkfrflnelikvvspkylgdrvsekvktkviellys
wtmalpeeakikdayhmlkrqgivqsdppipvdrtli

Timeline for d1juqb1:

• d1juqb1 first appeared in SCOP 1.59, called d1juqb_
  
• d1juqb1 was called d1juqb_ in SCOPe 2.05
  
• d1juqb1 appears in SCOPe 2.07
  
• d1juqb1 appears in the current release, SCOPe 2.08