Lineage for d1jska_ (1jsk A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1048063Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1048064Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1048065Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1048292Protein NK cell-activating receptor nkg2d [64453] (2 species)
  7. 1048299Species Mouse (Mus musculus) [TaxId:10090] [64454] (2 PDB entries)
  8. 1048301Domain d1jska_: 1jsk A: [67230]
    Other proteins in same PDB: d1jskc_

Details for d1jska_

PDB Entry: 1jsk (more details), 3.5 Å

PDB Description: crystal structure of murine nk cell ligand rae-1 beta in complex with nkg2d
PDB Compounds: (A:) nkg2-d

SCOPe Domain Sequences for d1jska_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jska_ d.169.1.1 (A:) NK cell-activating receptor nkg2d {Mouse (Mus musculus) [TaxId: 10090]}
gycgpcpnnwichrnncyqffneektwnqsqasclsqnssllkiyskeeqdflklvksyh
wmglvqipangswqwedgsslsynqltlveipkgscavygssfkaytedcanlntyicmk
rav

SCOPe Domain Coordinates for d1jska_:

Click to download the PDB-style file with coordinates for d1jska_.
(The format of our PDB-style files is described here.)

Timeline for d1jska_: