Lineage for d1jpnb2 (1jpn B:89-295)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2126015Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 2126154Protein GTPase domain of the signal sequence recognition protein Ffh [52664] (3 species)
  7. 2126165Species Thermus aquaticus [TaxId:271] [52665] (17 PDB entries)
  8. 2126178Domain d1jpnb2: 1jpn B:89-295 [67042]
    Other proteins in same PDB: d1jpna1, d1jpnb1
    complexed with acy, ca, gnp

Details for d1jpnb2

PDB Entry: 1jpn (more details), 1.9 Å

PDB Description: GMPPNP Complex of SRP GTPase NG Domain
PDB Compounds: (B:) signal recognition particle protein

SCOPe Domain Sequences for d1jpnb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jpnb2 c.37.1.10 (B:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}
earlpvlkdrnlwflvglqgsgktttaaklalyykgkgrrpllvaadtqrpaareqlrll
gekvgvpvlevmdgespesirrrveekarleardlilvdtagrlqideplmgelarlkev
lgpdevllvldamtgqealsvarafdekvgvtglvltkldgdarggaalsarhvtgkpiy
fagvsekpeglepfyperlagrilgmg

SCOPe Domain Coordinates for d1jpnb2:

Click to download the PDB-style file with coordinates for d1jpnb2.
(The format of our PDB-style files is described here.)

Timeline for d1jpnb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jpnb1