SCOP 1.65: Domain d1jpmd2: 1jpm D:1-125

Lineage for d1jpmd2 (1jpm D:1-125)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (8 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein L-Ala-D/L-Glu epimerase [69711] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [69713] (1 PDB entry)

8. Domain d1jpmd2: 1jpm D:1-125 [67038]
   Other proteins in same PDB: d1jpma1, d1jpmb1, d1jpmc1, d1jpmd1
   complexed with gol, mg

Details for d1jpmd2

PDB Entry: 1jpm, 2.25 Å

PDB Description: L-Ala-D/L-Glu Epimerase

SCOP Domain Sequences for d1jpmd2:

Sequence; same for both SEQRES and ATOM records:

>d1jpmd2 d.54.1.1 (D:1-125) L-Ala-D/L-Glu epimerase {Bacillus subtilis}
mkiirietsriavpltkpfktalrtvytaesvivritydsgavgwgeapptlvitgdsmd
siesaihhvlkpallgkslagyeailhdiqhlltgnmsakaavemalydgwaqmcglply
qmlgg

Timeline for d1jpmd2:

• d1jpmd2 first appeared in SCOP 1.59
  
• d1jpmd2 appears in SCOP 1.63
  
• d1jpmd2 appears in SCOP 1.67
  
• d1jpmd2 appears in the current release, SCOPe 2.08