Lineage for d1jpmd2 (1jpm D:1-125)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 256875Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 256876Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 256877Family d.54.1.1: Enolase N-terminal domain-like [54827] (8 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 256949Protein L-Ala-D/L-Glu epimerase [69711] (2 species)
  7. 256950Species Bacillus subtilis [TaxId:1423] [69713] (1 PDB entry)
  8. 256954Domain d1jpmd2: 1jpm D:1-125 [67038]
    Other proteins in same PDB: d1jpma1, d1jpmb1, d1jpmc1, d1jpmd1
    complexed with gol, mg

Details for d1jpmd2

PDB Entry: 1jpm (more details), 2.25 Å

PDB Description: L-Ala-D/L-Glu Epimerase

SCOP Domain Sequences for d1jpmd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jpmd2 d.54.1.1 (D:1-125) L-Ala-D/L-Glu epimerase {Bacillus subtilis}
mkiirietsriavpltkpfktalrtvytaesvivritydsgavgwgeapptlvitgdsmd
siesaihhvlkpallgkslagyeailhdiqhlltgnmsakaavemalydgwaqmcglply
qmlgg

SCOP Domain Coordinates for d1jpmd2:

Click to download the PDB-style file with coordinates for d1jpmd2.
(The format of our PDB-style files is described here.)

Timeline for d1jpmd2: