Lineage for d1jnya2 (1jny A:323-429)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 464914Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 464915Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 464916Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (4 proteins)
  6. 464917Protein Elongation factor eEF-1alpha, C-terminal domain [50472] (2 species)
    eukaryotic and archaeal homologue of EF-Tu
  7. 464918Species Archaeon Sulfolobus solfataricus [TaxId:2287] [69277] (2 PDB entries)
  8. 464919Domain d1jnya2: 1jny A:323-429 [66983]
    Other proteins in same PDB: d1jnya1, d1jnya3, d1jnyb1, d1jnyb3

Details for d1jnya2

PDB Entry: 1jny (more details), 1.8 Å

PDB Description: Crystal structure of Sulfolobus solfataricus elongation factor 1 alpha in complex with GDP

SCOP Domain Sequences for d1jnya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jnya2 b.44.1.1 (A:323-429) Elongation factor eEF-1alpha, C-terminal domain {Archaeon Sulfolobus solfataricus}
adeftariivvwhptalangytpvlhvhtasvacrvselvskldprtgqeaeknpqflkq
gdvaivkfkpikplcvekynefpplgrfamrdmgktvgvgiivdvkp

SCOP Domain Coordinates for d1jnya2:

Click to download the PDB-style file with coordinates for d1jnya2.
(The format of our PDB-style files is described here.)

Timeline for d1jnya2: