Lineage for d1jnya1 (1jny A:228-322)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 464636Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 464647Superfamily b.43.3: Translation proteins [50447] (2 families) (S)
  5. 464648Family b.43.3.1: Elongation factors [50448] (8 proteins)
  6. 464655Protein Elongation factor eEF-1alpha, domain 2 [50454] (2 species)
    eukaryotic and archaeal homologue of EF-Tu
  7. 464656Species Archaeon Sulfolobus solfataricus [TaxId:2287] [69276] (2 PDB entries)
  8. 464657Domain d1jnya1: 1jny A:228-322 [66982]
    Other proteins in same PDB: d1jnya2, d1jnya3, d1jnyb2, d1jnyb3

Details for d1jnya1

PDB Entry: 1jny (more details), 1.8 Å

PDB Description: Crystal structure of Sulfolobus solfataricus elongation factor 1 alpha in complex with GDP

SCOP Domain Sequences for d1jnya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jnya1 b.43.3.1 (A:228-322) Elongation factor eEF-1alpha, domain 2 {Archaeon Sulfolobus solfataricus}
pvdkplripiqdvysisgvgtvpvgrvesgvlkvgdkivfmpagkvgevrsiethhtkmd
kaepgdnigfnvrgvekkdikrgdvvghpnnpptv

SCOP Domain Coordinates for d1jnya1:

Click to download the PDB-style file with coordinates for d1jnya1.
(The format of our PDB-style files is described here.)

Timeline for d1jnya1: