SCOP 1.69: Domain d1jnyb1: 1jny B:228-322

Lineage for d1jnyb1 (1jny B:228-322)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (2 families)

5. Family b.43.3.1: Elongation factors [50448] (8 proteins)

6. Protein Elongation factor eEF-1alpha, domain 2 [50454] (2 species)
   eukaryotic and archaeal homologue of EF-Tu

7. Species Archaeon Sulfolobus solfataricus [TaxId:2287] [69276] (2 PDB entries)

8. Domain d1jnyb1: 1jny B:228-322 [66985]
   Other proteins in same PDB: d1jnya2, d1jnya3, d1jnyb2, d1jnyb3

Details for d1jnyb1

PDB Entry: 1jny, 1.8 Å

PDB Description: Crystal structure of Sulfolobus solfataricus elongation factor 1 alpha in complex with GDP

SCOP Domain Sequences for d1jnyb1:

Sequence; same for both SEQRES and ATOM records:

>d1jnyb1 b.43.3.1 (B:228-322) Elongation factor eEF-1alpha, domain 2 {Archaeon Sulfolobus solfataricus}
pvdkplripiqdvysisgvgtvpvgrvesgvlkvgdkivfmpagkvgevrsiethhtkmd
kaepgdnigfnvrgvekkdikrgdvvghpnnpptv

Timeline for d1jnyb1:

• d1jnyb1 first appeared in SCOP 1.59
  
• d1jnyb1 appears in SCOP 1.67
  
• d1jnyb1 appears in SCOP 1.71
  
• d1jnyb1 appears in the current release, SCOPe 2.08