SCOPe 2.05: Domain d1jgia1: 1jgi A:555-628

Lineage for d1jgia1 (1jgi A:555-628)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Amylosucrase [69328] (1 species)

7. Species Neisseria polysaccharea [TaxId:489] [69329] (10 PDB entries)

8. Domain d1jgia1: 1jgi A:555-628 [66676]
   Other proteins in same PDB: d1jgia2
   complexed with suc; mutant

Details for d1jgia1

PDB Entry: 1jgi, 2 Å

PDB Description: crystal structure of the active site mutant glu328gln of amylosucrase from neisseria polysaccharea in complex with the natural substrate sucrose

PDB Compounds: (A:) amylosucrase

SCOPe Domain Sequences for d1jgia1:

Sequence; same for both SEQRES and ATOM records:

>d1jgia1 b.71.1.1 (A:555-628) Amylosucrase {Neisseria polysaccharea [TaxId: 489]}
rlvtfntnnkhiigyirnnallafgnfseypqtvtahtlqampfkahdliggktvslnqd
ltlqpyqvmwleia

Timeline for d1jgia1:

• d1jgia1 first appeared in SCOP 1.59
  
• d1jgia1 appears in SCOPe 2.04
  
• d1jgia1 appears in SCOPe 2.06
  
• d1jgia1 appears in the current release, SCOPe 2.08