SCOPe 2.03: Domain d1jfta1: 1jft A:2-58

Lineage for d1jfta1 (1jft A:2-58)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (4 proteins)
   lacks the first helix of canonical fold
   3 helices; bundle, partly opened, right-handed twist

6. Protein Purine repressor (PurR), N-terminal domain [47439] (1 species)

7. Species Escherichia coli [TaxId:562] [47440] (24 PDB entries)

8. Domain d1jfta1: 1jft A:2-58 [66652]
   Other proteins in same PDB: d1jfta2
   protein/DNA complex; complexed with hpa, po4; mutant

Details for d1jfta1

PDB Entry: 1jft, 2.5 Å

PDB Description: purine repressor mutant-hypoxanthine-purf operator complex

PDB Compounds: (A:) purine nucleotide synthesis repressor

SCOPe Domain Sequences for d1jfta1:

Sequence; same for both SEQRES and ATOM records:

>d1jfta1 a.35.1.5 (A:2-58) Purine repressor (PurR), N-terminal domain {Escherichia coli [TaxId: 562]}
atikdvakranvstttvshvinktrfvaeetrnavwaaikelhyspsavarslkvnh

Timeline for d1jfta1:

• d1jfta1 first appeared in SCOP 1.59
  
• d1jfta1 appears in SCOPe 2.02
  
• d1jfta1 appears in SCOPe 2.04
  
• d1jfta1 appears in the current release, SCOPe 2.08