SCOP 1.59: Domain d1jfta1: 1jft A:2-58

Lineage for d1jfta1 (1jft A:2-58)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (5 families)

5. Family a.35.1.5: Bacterial repressors [47438] (3 proteins)

6. Protein Purine repressor (PurR), N-terminal domain [47439] (1 species)

7. Species Escherichia coli [TaxId:562] [47440] (24 PDB entries)

8. Domain d1jfta1: 1jft A:2-58 [66652]
   Other proteins in same PDB: d1jfta2

Details for d1jfta1

PDB Entry: 1jft, 2.5 Å

PDB Description: purine repressor mutant-hypoxanthine-purf operator complex

SCOP Domain Sequences for d1jfta1:

Sequence; same for both SEQRES and ATOM records:

>d1jfta1 a.35.1.5 (A:2-58) Purine repressor (PurR), N-terminal domain {Escherichia coli}
atikdvakranvstttvshvinktrfvaeetrnavwaaikelhyspsavarslkvnh

Timeline for d1jfta1:

• d1jfta1 is new in SCOP 1.59
  
• d1jfta1 appears in SCOP 1.61
  
• d1jfta1 appears in the current release, SCOPe 2.08