Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.4: Class I DAHP synthetase [51599] (3 proteins) |
Protein 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) [51602] (5 species) |
Species Aquifex aeolicus [TaxId:63363] [63922] (32 PDB entries) |
Domain d1jcxa_: 1jcx A: [66510] complexed with cd, pai |
PDB Entry: 1jcx (more details), 1.8 Å
SCOPe Domain Sequences for d1jcxa_:
Sequence, based on SEQRES records: (download)
>d1jcxa_ c.1.10.4 (A:) 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) {Aquifex aeolicus [TaxId: 63363]} ekflviagpcaieseelllkvgeeikrlsekfkevefvfkssfdkanrssihsfrghgle ygvkalrkvkeefglkittdiheswqaepvaevadiiqipaflcrqtdlllaaaktgrav nvkkgqflapwdtknvveklkfggakeiyltergttfgynnlvvdfrslpimkqwakviy dathsvqlpgglgdksggmrefifpliraavavgcdgvfmethpepekalsdastqlpls qlegiieaileirevaskyyeti
>d1jcxa_ c.1.10.4 (A:) 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) {Aquifex aeolicus [TaxId: 63363]} ekflviagpcaieseelllkvgeeikrlsekfkevefvfkssfdkanrssihsfrghgle ygvkalrkvkeefglkittdiheswqaepvaevadiiqipaflcrqtdlllaaaktgrav nvkkgqflapwdtknvveklkfggakeiyltergttfgynnlvvdfrslpimkqwakviy dathsvqlpgmrefifpliraavavgcdgvfmethpepekalsdastqlplsqlegiiea ileirevaskyyeti
Timeline for d1jcxa_: