SCOP 1.61: Domain d1jaxb_: 1jax B:

Lineage for d1jaxb_ (1jax B:)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families)

5. Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (9 proteins)

6. Protein Coenzyme F420H2:NADP+ oxidoreductase (FNO) [69421] (1 species)

7. Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [69422] (2 PDB entries)

8. Domain d1jaxb_: 1jax B: [66477]

Details for d1jaxb_

PDB Entry: 1jax, 1.8 Å

PDB Description: Structure of Coenzyme F420H2:NADP+ Oxidoreductase (FNO)

SCOP Domain Sequences for d1jaxb_:

Sequence; same for both SEQRES and ATOM records:

>d1jaxb_ c.2.1.6 (B:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus}
mrvallggtgnlgkglalrlatlgheivvgsrreekaeakaaeyrriagdasitgmkned
aaeacdiavltipwehaidtardlknilrekivvsplvpvsrgakgftyssersaaeiva
evlesekvvsalhtipaarfanldekfdwdvpvcgdddeskkvvmsliseidglrpldag
plsnsrlvesltplilnimrfngmgelgikfl

Timeline for d1jaxb_:

• d1jaxb_ first appeared in SCOP 1.59
  
• d1jaxb_ appears in SCOP 1.63
  
• d1jaxb_ appears in the current release, SCOPe 2.08