Lineage for d1jaxb_ (1jax B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2844998Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins)
    the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
    C-terminal domains also show some similarity
  6. 2845033Protein Coenzyme F420H2:NADP+ oxidoreductase (FNO) [69421] (1 species)
    lacks all but the first helix of the C-terminal all-alpha domain
  7. 2845034Species Archaeoglobus fulgidus [TaxId:2234] [69422] (2 PDB entries)
  8. 2845038Domain d1jaxb_: 1jax B: [66477]
    complexed with mg, na

Details for d1jaxb_

PDB Entry: 1jax (more details), 1.8 Å

PDB Description: Structure of Coenzyme F420H2:NADP+ Oxidoreductase (FNO)
PDB Compounds: (B:) conserved hypothetical protein

SCOPe Domain Sequences for d1jaxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jaxb_ c.2.1.6 (B:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeoglobus fulgidus [TaxId: 2234]}
mrvallggtgnlgkglalrlatlgheivvgsrreekaeakaaeyrriagdasitgmkned
aaeacdiavltipwehaidtardlknilrekivvsplvpvsrgakgftyssersaaeiva
evlesekvvsalhtipaarfanldekfdwdvpvcgdddeskkvvmsliseidglrpldag
plsnsrlvesltplilnimrfngmgelgikfl

SCOPe Domain Coordinates for d1jaxb_:

Click to download the PDB-style file with coordinates for d1jaxb_.
(The format of our PDB-style files is described here.)

Timeline for d1jaxb_: