Lineage for d1j78a1 (1j78 A:13-198)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2730252Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2730253Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2730254Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 2730668Protein Vitamin D binding protein [69111] (1 species)
    domain 3 lacks the last subdomain
  7. 2730669Species Human (Homo sapiens) [TaxId:9606] [69112] (6 PDB entries)
  8. 2730685Domain d1j78a1: 1j78 A:13-198 [66397]
    complexed with ola, vdy

Details for d1j78a1

PDB Entry: 1j78 (more details), 2.31 Å

PDB Description: crystallographic analysis of the human vitamin d binding protein
PDB Compounds: (A:) vitamin D binding protein

SCOPe Domain Sequences for d1j78a1:

Sequence, based on SEQRES records: (download)

>d1j78a1 a.126.1.1 (A:13-198) Vitamin D binding protein {Human (Homo sapiens) [TaxId: 9606]}
ckefshlgkedftslslvlysrkfpsgtfeqvsqlvkevvslteaccaegadpdcydtrt
salsakscesnspfpvhpgtaecctkeglerklcmaalkhqpqefptyveptndeiceaf
rkdpkeyanqfmweystnygqaplsllvsytksylsmvgscctsasptvcflkerlqlkh
lslltt

Sequence, based on observed residues (ATOM records): (download)

>d1j78a1 a.126.1.1 (A:13-198) Vitamin D binding protein {Human (Homo sapiens) [TaxId: 9606]}
ckefshlgkedftslslvlysrkfpsgtfeqvsqlvkevvslteaccydtrtsalsaksc
esnspfpvhpgtaecctkrklcmaalkhqpqefptyveptndeiceafrkdpkeyanqfm
weystnygqaplsllvsytksylsmvgscctsasptvcflkerlqlkhlslltt

SCOPe Domain Coordinates for d1j78a1:

Click to download the PDB-style file with coordinates for d1j78a1.
(The format of our PDB-style files is described here.)

Timeline for d1j78a1: