Lineage for d1irjf_ (1irj F:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 97344Fold a.39: EF Hand-like [47472] (4 superfamilies)
  4. 97345Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 97368Family a.39.1.2: S100 proteins [47478] (1 protein)
  6. 97369Protein Calcyclin (S100) [47479] (11 species)
  7. 97391Species Human (Homo sapiens), s100a9 (mrp14) [TaxId:9606] [69020] (1 PDB entry)
  8. 97397Domain d1irjf_: 1irj F: [66294]

Details for d1irjf_

PDB Entry: 1irj (more details), 2.1 Å

PDB Description: Crystal Structure of the MRP14 complexed with CHAPS

SCOP Domain Sequences for d1irjf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1irjf_ a.39.1.2 (F:) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14)}
ckmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekviehi
medldtnadkqlsfeefimlmarl

SCOP Domain Coordinates for d1irjf_:

Click to download the PDB-style file with coordinates for d1irjf_.
(The format of our PDB-style files is described here.)

Timeline for d1irjf_: