Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) N-terminal domain is the classic Rossmann-fold |
Family d.81.1.1: GAPDH-like [55348] (6 proteins) has many additional secondary structures |
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species) |
Species Trypanosome (Leishmania mexicana) [TaxId:5665] [55357] (5 PDB entries) |
Domain d1i32d2: 1i32 D:166-334 [66000] Other proteins in same PDB: d1i32a1, d1i32b1, d1i32c1, d1i32d1, d1i32e1, d1i32f1 complexed with nmd |
PDB Entry: 1i32 (more details), 2.6 Å
SCOPe Domain Sequences for d1i32d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i32d2 d.81.1.1 (D:166-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosome (Leishmania mexicana) [TaxId: 5665]} cttnclapivhvltkenfgietglmttihsytatqktvdgvslkdwrggraaavniipst tgaakavgmvipstkgkltgmsfrvptpdvsvvdltfratrdtsiqeidkaikkaaqtym kgilgftdeelvsadfindnrssvydskatlqnnlpgekrffkvvswyd
Timeline for d1i32d2: