Class a: All alpha proteins [46456] (171 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (36 families) contains a small beta-sheet (wing) |
Family a.4.5.32: Lrp/AsnC-like transcriptional regulator N-terminal domain [68967] (1 protein) Swapped dimer with the "wing" C-terminal strands |
Protein LprA [68968] (1 species) |
Species Archaeon Pyrococcus furiosus [TaxId:2261] [68969] (1 PDB entry) |
Domain d1i1gb1: 1i1g B:2-61 [65984] Other proteins in same PDB: d1i1ga2, d1i1gb2 |
PDB Entry: 1i1g (more details), 2.9 Å
SCOP Domain Sequences for d1i1gb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i1gb1 a.4.5.32 (B:2-61) LprA {Archaeon Pyrococcus furiosus} iderdkiileilekdartpfteiakklgisetavrkrvkaleekgiiegytikinpkklg
Timeline for d1i1gb1: