SCOPe 2.04: Domain d1hzbb_: 1hzb B:

Lineage for d1hzbb_ (1hzb B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
   barrel, closed; n=5, S=8

6. Protein Major cold shock protein [50283] (4 species)

7. Species Bacillus caldolyticus [TaxId:1394] [50286] (7 PDB entries)

8. Domain d1hzbb_: 1hzb B: [65966]
   complexed with na; mutant

Details for d1hzbb_

PDB Entry: 1hzb, 1.28 Å

PDB Description: bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability

PDB Compounds: (B:) Cold shock protein cspB

SCOPe Domain Sequences for d1hzbb_:

Sequence; same for both SEQRES and ATOM records:

>d1hzbb_ b.40.4.5 (B:) Major cold shock protein {Bacillus caldolyticus [TaxId: 1394]}
mqrgkvkwfnnekgygfieveggsdvfvhftaiqgegfktleegqevsfeivqgnrgpqa
anvvke

Timeline for d1hzbb_:

• d1hzbb_ first appeared in SCOP 1.59
  
• d1hzbb_ appears in SCOPe 2.03
  
• d1hzbb_ appears in SCOPe 2.05
  
• d1hzbb_ appears in the current release, SCOPe 2.08