PDB entry 1hzb

View 1hzb on RCSB PDB site
Description: bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability
Class: transcription
Keywords: beta barrel, homodimer, transcription
Deposited on 2001-01-24, released 2001-11-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.28 Å
R-factor: 0.162
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cold shock protein cspB
    Species: Bacillus caldolyticus [TaxId:1394]
    Gene: cspB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41016 (0-65)
      • engineered (65)
    Domains in SCOPe 2.04: d1hzba_
  • Chain 'B':
    Compound: Cold shock protein cspB
    Species: Bacillus caldolyticus [TaxId:1394]
    Gene: cspB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41016 (0-65)
      • engineered (65)
    Domains in SCOPe 2.04: d1hzbb_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hzbA (A:)
    mqrgkvkwfnnekgygfieveggsdvfvhftaiqgegfktleegqevsfeivqgnrgpqa
    anvvke
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hzbB (B:)
    mqrgkvkwfnnekgygfieveggsdvfvhftaiqgegfktleegqevsfeivqgnrgpqa
    anvvke