Lineage for d1hy5a_ (1hy5 A:)
- Root: SCOP 1.59
Class a: All alpha proteins [46456] (151 folds) 
Fold a.24: Four-helical up-and-down bundle [47161] (14 superfamilies) 
Superfamily a.24.11: Bacterial GAP domain [47233] (1 family) 
Family a.24.11.1: Bacterial GAP domain [47234] (3 proteins) 
Protein YopE [68998] (1 species) Species Yersinia pestis [TaxId:632] [68999] (1 PDB entry) 
Domain d1hy5a_: 1hy5 A: [65955]
Details for d1hy5a_
PDB Entry: 1hy5 (more details), 2.25 Å
PDB Description: crystal structure of the catalytic domain of yope-yersinia pestis gap effector protein.
SCOP Domain Sequences for d1hy5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hy5a_ a.24.11.1 (A:) YopE {Yersinia pestis}
tsfsdsikqlaaetlpkymqqlnsldaemlqknhdqfatgsgplrgsitqcqglmqfcgg
elqaeasailntpvcgipfsqwgtiggaasayvasgvdltqaaneikglaqqmqkllslm
SCOP Domain Coordinates for d1hy5a_:
Click to download the PDB-style file with coordinates for d1hy5a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hy5a_:
- d1hy5a_ is new in SCOP 1.59
- d1hy5a_ appears in SCOP 1.61
- d1hy5a_ appears in the current release, SCOPe 2.08
View in 3D
