Class a: All alpha proteins [46456] (290 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.11: Bacterial GAP domain [47233] (1 family) contains extra helices in the loops at one end of the bundle |
Family a.24.11.1: Bacterial GAP domain [47234] (4 proteins) |
Protein YopE [68998] (1 species) |
Species Yersinia pestis [TaxId:632] [68999] (1 PDB entry) |
Domain d1hy5a_: 1hy5 A: [65955] Other proteins in same PDB: d1hy5b2 |
PDB Entry: 1hy5 (more details), 2.25 Å
SCOPe Domain Sequences for d1hy5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hy5a_ a.24.11.1 (A:) YopE {Yersinia pestis [TaxId: 632]} tsfsdsikqlaaetlpkymqqlnsldaemlqknhdqfatgsgplrgsitqcqglmqfcgg elqaeasailntpvcgipfsqwgtiggaasayvasgvdltqaaneikglaqqmqkllslm
Timeline for d1hy5a_: