Lineage for d1hy5a_ (1hy5 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700261Superfamily a.24.11: Bacterial GAP domain [47233] (1 family) (S)
    contains extra helices in the loops at one end of the bundle
  5. 2700262Family a.24.11.1: Bacterial GAP domain [47234] (4 proteins)
  6. 2700272Protein YopE [68998] (1 species)
  7. 2700273Species Yersinia pestis [TaxId:632] [68999] (1 PDB entry)
  8. 2700274Domain d1hy5a_: 1hy5 A: [65955]
    Other proteins in same PDB: d1hy5b2

Details for d1hy5a_

PDB Entry: 1hy5 (more details), 2.25 Å

PDB Description: crystal structure of the catalytic domain of yope-yersinia pestis gap effector protein.
PDB Compounds: (A:) yersinia pestis virulence protein yope

SCOPe Domain Sequences for d1hy5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hy5a_ a.24.11.1 (A:) YopE {Yersinia pestis [TaxId: 632]}
tsfsdsikqlaaetlpkymqqlnsldaemlqknhdqfatgsgplrgsitqcqglmqfcgg
elqaeasailntpvcgipfsqwgtiggaasayvasgvdltqaaneikglaqqmqkllslm

SCOPe Domain Coordinates for d1hy5a_:

Click to download the PDB-style file with coordinates for d1hy5a_.
(The format of our PDB-style files is described here.)

Timeline for d1hy5a_: