Lineage for d1h5td_ (1h5t D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1868080Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 1868081Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 1868242Family c.68.1.6: glucose-1-phosphate thymidylyltransferase [53464] (4 proteins)
    automatically mapped to Pfam PF00483
  6. 1868261Protein RmlA (RfbA) [53465] (5 species)
  7. 1868279Species Escherichia coli [TaxId:562] [69568] (3 PDB entries)
  8. 1868283Domain d1h5td_: 1h5t D: [65634]
    complexed with dau, so4, tyd

Details for d1h5td_

PDB Entry: 1h5t (more details), 1.9 Å

PDB Description: thymidylyltransferase complexed with thymidylyldiphosphate-glucose
PDB Compounds: (D:) glucose-1-phosphate thymidylyltransferase

SCOPe Domain Sequences for d1h5td_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h5td_ c.68.1.6 (D:) RmlA (RfbA) {Escherichia coli [TaxId: 562]}
kmrkgiilaggsgtrlypvtmavskqllpiydkpmiyyplstlmlagirdiliistpqdt
prfqqllgdgsqwglnlqykvqpspdglaqafiigeefiggddcalvlgdnifyghdlpk
lmeaavnkesgatvfayhvndperygvvefdkngtaisleekplepksnyavtglyfydn
dvvqmaknlkpsargeleitdinriyleqgrlsvammgrgyawldtgthqslieasnfia
tieerqglkvscpeeiafrkgfidveqvrklavpliknnygqylykmtkd

SCOPe Domain Coordinates for d1h5td_:

Click to download the PDB-style file with coordinates for d1h5td_.
(The format of our PDB-style files is described here.)

Timeline for d1h5td_: