Lineage for d1h5ta_ (1h5t A:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (11 families) 
Family c.68.1.6: glucose-1-phosphate thymidylyltransferase RmlA [53464] (1 protein) Protein glucose-1-phosphate thymidylyltransferase RmlA [53465] (3 species) 
Species Escherichia coli [TaxId:562] [69568] (3 PDB entries) 
Domain d1h5ta_: 1h5t A: [65631]
Details for d1h5ta_
PDB Entry: 1h5t (more details), 1.9 Å
PDB Description: thymidylyltransferase complexed with thymidylyldiphosphate-glucose
SCOP Domain Sequences for d1h5ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h5ta_ c.68.1.6 (A:) glucose-1-phosphate thymidylyltransferase RmlA {Escherichia coli}
kmrkgiilaggsgtrlypvtmavskqllpiydkpmiyyplstlmlagirdiliistpqdt
prfqqllgdgsqwglnlqykvqpspdglaqafiigeefiggddcalvlgdnifyghdlpk
lmeaavnkesgatvfayhvndperygvvefdkngtaisleekplepksnyavtglyfydn
dvvqmaknlkpsargeleitdinriyleqgrlsvammgrgyawldtgthqslieasnfia
tieerqglkvscpeeiafrkgfidveqvrklavpliknnygqylykmtkd
SCOP Domain Coordinates for d1h5ta_:
Click to download the PDB-style file with coordinates for d1h5ta_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1h5ta_:
- d1h5ta_ is new in SCOP 1.59
- d1h5ta_ appears in SCOP 1.61
- d1h5ta_ appears in the current release, SCOPe 2.08
View in 3D
