![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.10: Hairpin loop containing domain-like [57413] (1 superfamily) alpha+beta fold with two crossing loops |
![]() | Superfamily g.10.1: Hairpin loop containing domain-like [57414] (3 families) ![]() the middle part is structurally similar to some knottins and defensins but differs in the disulfide pattern |
![]() | Family g.10.1.1: Hairpin loop containing domain [57415] (2 proteins) automatically mapped to Pfam PF00024 |
![]() | Protein Hepatocyte growth factor [57416] (1 species) heparin-binding domain |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57417] (21 PDB entries) |
![]() | Domain d1gmnb1: 1gmn B:42-125 [65317] Other proteins in same PDB: d1gmna2, d1gmnb2 complexed with epe, ids, sgn |
PDB Entry: 1gmn (more details), 2.3 Å
SCOPe Domain Sequences for d1gmnb1:
Sequence, based on SEQRES records: (download)
>d1gmnb1 g.10.1.1 (B:42-125) Hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]} fkksakttlikidpalkiktkkvntadqcadrctrnkglpftckafvfdkarkqclwfpf nsmssgvkkefghefdlyenkdyi
>d1gmnb1 g.10.1.1 (B:42-125) Hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]} fkksakttlickafwfpfnsmlyenkdyi
Timeline for d1gmnb1: