Class g: Small proteins [56992] (98 folds) |
Fold g.10: Hairpin loop containing domain-like [57413] (1 superfamily) alpha+beta fold with two crossing loops |
Superfamily g.10.1: Hairpin loop containing domain-like [57414] (3 families) the middle part is structurally similar to some knottins and defensins but differs in the disulfide pattern |
Family g.10.1.1: Hairpin loop containing domain [57415] (2 proteins) automatically mapped to Pfam PF00024 |
Protein Hepatocyte growth factor [57416] (1 species) heparin-binding domain |
Species Human (Homo sapiens) [TaxId:9606] [57417] (21 PDB entries) |
Domain d1gmna1: 1gmn A:38-125 [65315] Other proteins in same PDB: d1gmna2, d1gmnb2 complexed with epe, ids, sgn |
PDB Entry: 1gmn (more details), 2.3 Å
SCOPe Domain Sequences for d1gmna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gmna1 g.10.1.1 (A:38-125) Hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]} tihefkksakttlikidpalkiktkkvntadqcadrctrnkglpftckafvfdkarkqcl wfpfnsmssgvkkefghefdlyenkdyi
Timeline for d1gmna1: