Class g: Small proteins [56992] (66 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (18 superfamilies) disulphide-bound fold; contains beta-hairpin with two adjacent disulphides |
Superfamily g.3.11: EGF/Laminin [57196] (6 families) |
Family g.3.11.1: EGF-type module [57197] (20 proteins) |
Protein E-selectin, EGF-domain [57203] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57204] (5 PDB entries) |
Domain d1g1sa2: 1g1s A:119-158 [65101] Other proteins in same PDB: d1g1sa1, d1g1sb1 |
PDB Entry: 1g1s (more details), 1.9 Å
SCOP Domain Sequences for d1g1sa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens)} tascqdmscskqgecletignytcscypgfygpeceyvrd
Timeline for d1g1sa2: