Lineage for d1ep8a_ (1ep8 A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 395822Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 395823Superfamily c.47.1: Thioredoxin-like [52833] (14 families) (S)
  5. 395824Family c.47.1.1: Thioltransferase [52834] (9 proteins)
  6. 395871Protein Thioredoxin [52835] (9 species)
  7. 395888Species Chlamydomonas reinhardtii [TaxId:3055] [52838] (4 PDB entries)
  8. 395891Domain d1ep8a_: 1ep8 A: [64907]

Details for d1ep8a_

PDB Entry: 1ep8 (more details), 2.2 Å

PDB Description: crystal structure of a mutated thioredoxin, d30a, from chlamydomonas reinhardtii

SCOP Domain Sequences for d1ep8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ep8a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii}
ggsvividskaawdaqlakgkeehkpivvaftatwcgpckmiaplfetlsndyagkvifl
kvdvdavaavaeaagitamptfhvykdgvkaddlvgasqdklkalvakhaaa

SCOP Domain Coordinates for d1ep8a_:

Click to download the PDB-style file with coordinates for d1ep8a_.
(The format of our PDB-style files is described here.)

Timeline for d1ep8a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ep8b_