PDB entry 1ep8

View 1ep8 on RCSB PDB site
Description: crystal structure of a mutated thioredoxin, d30a, from chlamydomonas reinhardtii
Deposited on 2000-03-28, released 2001-12-12
The last revision prior to the SCOP 1.67 freeze date was dated 2001-12-12, with a file datestamp of 2001-12-12.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.196
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1ep8a_
  • Chain 'B':
    Domains in SCOP 1.67: d1ep8b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ep8A (A:)
    ggsvividskaawdaqlakgkeehkpivvaftatwcgpckmiaplfetlsndyagkvifl
    kvdvdavaavaeaagitamptfhvykdgvkaddlvgasqdklkalvakhaaa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ep8B (B:)
    ggsvividskaawdaqlakgkeehkpivvaftatwcgpckmiaplfetlsndyagkvifl
    kvdvdavaavaeaagitamptfhvykdgvkaddlvgasqdklkalvakhaaa