Lineage for d1dbcb1 (1dbc B:138-205)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 149792Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 150081Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (35 families) (S)
  5. 150117Family a.4.5.4: CAP C-terminal domain-like [46796] (2 proteins)
  6. 150118Protein Catabolite gene activator protein (CAP), C-terminal domain [46797] (1 species)
  7. 150119Species Escherichia coli [TaxId:562] [46798] (11 PDB entries)
  8. 150136Domain d1dbcb1: 1dbc B:138-205 [64786]
    Other proteins in same PDB: d1dbca2, d1dbcb2

Details for d1dbcb1

PDB Entry: 1dbc (more details), 2.8 Å

PDB Description: protein-dna recognition and dna deformation revealed in crystal structures of cap-dna complexes

SCOP Domain Sequences for d1dbcb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dbcb1 a.4.5.4 (B:138-205) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivv

SCOP Domain Coordinates for d1dbcb1:

Click to download the PDB-style file with coordinates for d1dbcb1.
(The format of our PDB-style files is described here.)

Timeline for d1dbcb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dbcb2