Lineage for d1dbca2 (1dbc A:9-137)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 171721Fold b.82: Double-stranded beta-helix [51181] (6 superfamilies)
  4. 171884Superfamily b.82.3: cAMP-binding domain-like [51206] (2 families) (S)
  5. 171890Family b.82.3.2: cAMP-binding domain [51210] (2 proteins)
  6. 171891Protein Catabolite gene activator protein, N-terminal domain [51211] (1 species)
  7. 171892Species Escherichia coli [TaxId:562] [51212] (11 PDB entries)
  8. 171908Domain d1dbca2: 1dbc A:9-137 [64785]
    Other proteins in same PDB: d1dbca1, d1dbcb1

Details for d1dbca2

PDB Entry: 1dbc (more details), 2.8 Å

PDB Description: protein-dna recognition and dna deformation revealed in crystal structures of cap-dna complexes

SCOP Domain Sequences for d1dbca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dbca2 b.82.3.2 (A:9-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli}
ptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnqgd
figelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqvts
ekvgnlafl

SCOP Domain Coordinates for d1dbca2:

Click to download the PDB-style file with coordinates for d1dbca2.
(The format of our PDB-style files is described here.)

Timeline for d1dbca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dbca1