Lineage for d2a8vb2 (2a8v B:48-118)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 558996Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 559685Superfamily b.40.4: Nucleic acid-binding proteins [50249] (13 families) (S)
  5. 559965Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (22 proteins)
    barrel, closed; n=5, S=8
  6. 560063Protein Rho termination factor, RNA-binding domain [68910] (1 species)
  7. 560064Species Escherichia coli [TaxId:562] [68911] (8 PDB entries)
  8. 560069Domain d2a8vb2: 2a8v B:48-118 [64755]
    Other proteins in same PDB: d2a8va1, d2a8vb1, d2a8vc1

Details for d2a8vb2

PDB Entry: 2a8v (more details), 2.4 Å

PDB Description: rho transcription termination factor/rna complex

SCOP Domain Sequences for d2a8vb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a8vb2 b.40.4.5 (B:48-118) Rho termination factor, RNA-binding domain {Escherichia coli}
difgdgvleilqdgfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkeg
eryfallkvne

SCOP Domain Coordinates for d2a8vb2:

Click to download the PDB-style file with coordinates for d2a8vb2.
(The format of our PDB-style files is described here.)

Timeline for d2a8vb2: