Lineage for d2a8vb2 (2a8v B:48-118)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 110053Fold b.40: OB-fold [50198] (8 superfamilies)
  4. 110553Superfamily b.40.4: Nucleic acid-binding proteins [50249] (9 families) (S)
  5. 110688Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (13 proteins)
  6. 110730Protein Rho termination factor, RNA-binding domain [68910] (1 species)
  7. 110731Species Escherichia coli [TaxId:562] [68911] (4 PDB entries)
  8. 110736Domain d2a8vb2: 2a8v B:48-118 [64755]
    Other proteins in same PDB: d2a8va1, d2a8vb1, d2a8vc1

Details for d2a8vb2

PDB Entry: 2a8v (more details), 2.4 Å

PDB Description: rho transcription termination factor/rna complex

SCOP Domain Sequences for d2a8vb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a8vb2 b.40.4.5 (B:48-118) Rho termination factor, RNA-binding domain {Escherichia coli}
difgdgvleilqdgfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkeg
eryfallkvne

SCOP Domain Coordinates for d2a8vb2:

Click to download the PDB-style file with coordinates for d2a8vb2.
(The format of our PDB-style files is described here.)

Timeline for d2a8vb2: