SCOPe 2.03: Domain d1etua1: 1etu A:5-200

Lineage for d1etua1 (1etu A:5-200)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)

7. Species Escherichia coli [TaxId:562] [52627] (9 PDB entries)
   Uniprot P02990

8. Domain d1etua1: 1etu A:5-200 [64737]
   one domain only
   complexed with gdp, mg

Details for d1etua1

PDB Entry: 1etu, 2.9 Å

PDB Description: structural details of the binding of guanosine diphosphate to elongation factor tu from e. coli as studied by x-ray crystallography

PDB Compounds: (A:) elongation factor tu

SCOPe Domain Sequences for d1etua1:

Sequence, based on SEQRES records:

>d1etua1 c.37.1.8 (A:5-200) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Escherichia coli [TaxId: 562]}
fertkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitint
shveydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrq
vgvpyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaew
eakilelagfldsyip

Sequence, based on observed residues (ATOM records):

>d1etua1 c.37.1.8 (A:5-200) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Escherichia coli [TaxId: 562]}
fertkphvnvgtighvdhgkttltaaittvlaktygitintshveydtptrhyahvdcpg
hadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvpyiivflnkcdmvdde
ellelvemevrellsqydfpgddtpivrgsalkalegdaeweakilelagfldsyip

Timeline for d1etua1:

• d1etua1 first appeared in SCOP 1.59, called d1etu_1
  
• d1etua1 appears in SCOPe 2.02
  
• d1etua1 appears in SCOPe 2.04
  
• d1etua1 appears in the current release, SCOPe 2.08