Lineage for d1etu_1 (1etu 5-200)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121667Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 121668Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) (S)
  5. 121912Family c.37.1.8: G proteins [52592] (23 proteins)
  6. 122012Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)
  7. 122018Species Escherichia coli [TaxId:562] [52627] (6 PDB entries)
  8. 122027Domain d1etu_1: 1etu 5-200 [64737]

Details for d1etu_1

PDB Entry: 1etu (more details), 2.9 Å

PDB Description: structural details of the binding of guanosine diphosphate to elongation factor tu from e. coli as studied by x-ray crystallography

SCOP Domain Sequences for d1etu_1:

Sequence, based on SEQRES records: (download)

>d1etu_1 c.37.1.8 (5-200) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Escherichia coli}
fertkphvnvgtighvdhgkttltaaittvlaktyggaaxxxxxxxxxxxxxxxgitint
shveydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrq
vgvpyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaew
eakilelagfldsyip

Sequence, based on observed residues (ATOM records): (download)

>d1etu_1 c.37.1.8 (5-200) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Escherichia coli}
fertkphvnvgtighvdhgkttltaaittvlaktygitintshveydtptrhyahvdcpg
hadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvpyiivflnkcdmvdde
ellelvemevrellsqydfpgddtpivrgsalkalegdaeweakilelagfldsyip

SCOP Domain Coordinates for d1etu_1:

Click to download the PDB-style file with coordinates for d1etu_1.
(The format of our PDB-style files is described here.)

Timeline for d1etu_1: