SCOP 1.67: Domain d1a62_2: 1a62 48-125

Lineage for d1a62_2 (1a62 48-125)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.40: OB-fold [50198] (10 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (17 proteins)
   barrel, closed; n=5, S=8

6. Protein Rho termination factor, RNA-binding domain [68910] (1 species)

7. Species Escherichia coli [TaxId:562] [68911] (6 PDB entries)

8. Domain d1a62_2: 1a62 48-125 [64709]
   Other proteins in same PDB: d1a62_1

Details for d1a62_2

PDB Entry: 1a62, 1.55 Å

PDB Description: crystal structure of the rna-binding domain of the transcriptional terminator protein rho

SCOP Domain Sequences for d1a62_2:

Sequence; same for both SEQRES and ATOM records:

>d1a62_2 b.40.4.5 (48-125) Rho termination factor, RNA-binding domain {Escherichia coli}
difgdgvleilqdgfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkeg
eryfallkvnevnfdkpe

Timeline for d1a62_2:

• d1a62_2 first appeared in SCOP 1.59
  
• d1a62_2 appears in SCOP 1.65
  
• d1a62_2 appears in SCOP 1.69
  
• d1a62_2 appears in the current release, SCOPe 2.08, called d1a62a2