Lineage for d1a62_1 (1a62 1-47)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 218432Fold a.140: LEM/SAP HeH motif [63450] (4 superfamilies)
    helix-extended loop-helix; parallel helices
  4. 218455Superfamily a.140.3: Rho termination factor, N-terminal domain [68912] (1 family) (S)
  5. 218456Family a.140.3.1: Rho termination factor, N-terminal domain [68913] (1 protein)
  6. 218457Protein Rho termination factor, N-terminal domain [68914] (1 species)
  7. 218458Species Escherichia coli [TaxId:562] [50295] (4 PDB entries)
  8. 218459Domain d1a62_1: 1a62 1-47 [64708]
    Other proteins in same PDB: d1a62_2

Details for d1a62_1

PDB Entry: 1a62 (more details), 1.55 Å

PDB Description: crystal structure of the rna-binding domain of the transcriptional terminator protein rho

SCOP Domain Sequences for d1a62_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a62_1 a.140.3.1 (1-47) Rho termination factor, N-terminal domain {Escherichia coli}
mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksge

SCOP Domain Coordinates for d1a62_1:

Click to download the PDB-style file with coordinates for d1a62_1.
(The format of our PDB-style files is described here.)

Timeline for d1a62_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a62_2