Lineage for d1a62_1 (1a62 1-47)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 101768Fold a.140: LEM/SAP HeH motif [63450] (4 superfamilies)
  4. 101788Superfamily a.140.3: Rho termination factor, N-terminal domain [68912] (1 family) (S)
  5. 101789Family a.140.3.1: Rho termination factor, N-terminal domain [68913] (1 protein)
  6. 101790Protein Rho termination factor, N-terminal domain [68914] (1 species)
  7. 101791Species Escherichia coli [TaxId:562] [50295] (4 PDB entries)
  8. 101792Domain d1a62_1: 1a62 1-47 [64708]
    Other proteins in same PDB: d1a62_2

Details for d1a62_1

PDB Entry: 1a62 (more details), 1.55 Å

PDB Description: crystal structure of the rna-binding domain of the transcriptional terminator protein rho

SCOP Domain Sequences for d1a62_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a62_1 a.140.3.1 (1-47) Rho termination factor, N-terminal domain {Escherichia coli}
mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksge

SCOP Domain Coordinates for d1a62_1:

Click to download the PDB-style file with coordinates for d1a62_1.
(The format of our PDB-style files is described here.)

Timeline for d1a62_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a62_2