Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
Protein gamma subunit of DNA polymerase III, N-domain [64031] (2 species) |
Species Escherichia coli [TaxId:562] [64032] (3 PDB entries) Uniprot P06710 5-368 |
Domain d1jr3c2: 1jr3 C:3-242 [63250] Other proteins in same PDB: d1jr3a1, d1jr3b1, d1jr3c1, d1jr3d1, d1jr3d2, d1jr3e1, d1jr3e2 protein/DNA complex; complexed with so4, zn |
PDB Entry: 1jr3 (more details), 2.7 Å
SCOPe Domain Sequences for d1jr3c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jr3c2 c.37.1.20 (C:3-242) gamma subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} yqvlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllakgl ncetgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrfkv ylidevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldveq irhqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsamlg
Timeline for d1jr3c2: