Lineage for d1jqla3 (1jql A:245-366)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 84022Fold d.131: DNA clamp [55978] (1 superfamily)
  4. 84023Superfamily d.131.1: DNA clamp [55979] (2 families) (S)
  5. 84024Family d.131.1.1: DNA polymerase III, beta subunit [55980] (1 protein)
  6. 84025Protein DNA polymerase III, beta subunit [55981] (1 species)
  7. 84026Species Escherichia coli [TaxId:562] [55982] (2 PDB entries)
  8. 84035Domain d1jqla3: 1jql A:245-366 [63233]
    Other proteins in same PDB: d1jqlb_

Details for d1jqla3

PDB Entry: 1jql (more details), 2.5 Å

PDB Description: mechanism of processivity clamp opening by the delta subunit wrench of the clamp loader complex of e. coli dna polymerase iii: structure of beta-delta (1-140)

SCOP Domain Sequences for d1jqla3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jqla3 d.131.1.1 (A:245-366) DNA polymerase III, beta subunit {Escherichia coli}
rrvlpknpdkhleagcdllkqafaraaaasnekfrgvrlyvsenqlkitannpeqeeaee
ildvtysgaemeigfnvsyvldvlnalkcenvrmmltdsvssvqiedaasqsaayvvmpm
rl

SCOP Domain Coordinates for d1jqla3:

Click to download the PDB-style file with coordinates for d1jqla3.
(The format of our PDB-style files is described here.)

Timeline for d1jqla3:

View in 3D
Domains from other chains:
(mouse over for more information)
d1jqlb_