Lineage for d1jp3b_ (1jp3 B:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1187408Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156
  4. 1187409Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families) (S)
    the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase
  5. 1187410Family c.101.1.1: Undecaprenyl diphosphate synthase [64006] (2 proteins)
  6. 1187411Protein Undecaprenyl diphosphate synthase [64007] (2 species)
  7. 1187412Species Escherichia coli [TaxId:562] [64009] (3 PDB entries)
  8. 1187416Domain d1jp3b_: 1jp3 B: [63222]
    complexed with egc

Details for d1jp3b_

PDB Entry: 1jp3 (more details), 1.8 Å

PDB Description: Structure of E.coli undecaprenyl pyrophosphate synthase
PDB Compounds: (B:) undecaprenyl pyrophosphate synthase

SCOPe Domain Sequences for d1jp3b_:

Sequence, based on SEQRES records: (download)

>d1jp3b_ c.101.1.1 (B:) Undecaprenyl diphosphate synthase {Escherichia coli [TaxId: 562]}
gcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafssenwn
rpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntg
ltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtg
gehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafan

Sequence, based on observed residues (ATOM records): (download)

>d1jp3b_ c.101.1.1 (B:) Undecaprenyl diphosphate synthase {Escherichia coli [TaxId: 562]}
gcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafssalme
lfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntgltlniaanygg
rwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtggehrisnfllw
qiayaelyftdvlwpdfdeqdfegalnafan

SCOPe Domain Coordinates for d1jp3b_:

Click to download the PDB-style file with coordinates for d1jp3b_.
(The format of our PDB-style files is described here.)

Timeline for d1jp3b_: