SCOPe 2.05: Domain d1jgyl_: 1jgy L:

Lineage for d1jgyl_ (1jgy L:)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein L (light) subunit [81477] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81475] (61 PDB entries)
   Uniprot P02954

8. Domain d1jgyl_: 1jgy L: [63028]
   Other proteins in same PDB: d1jgyh1, d1jgyh2, d1jgym_
   complexed with bcl, bph, cdl, fe, spo, u10; mutant

Details for d1jgyl_

PDB Entry: 1jgy, 2.7 Å

PDB Description: photosynthetic reaction center mutant with tyr m 76 replaced with phe

PDB Compounds: (L:) Photosynthetic reaction center L subunit

SCOPe Domain Sequences for d1jgyl_:

Sequence; same for both SEQRES and ATOM records:

>d1jgyl_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

Timeline for d1jgyl_:

• d1jgyl_ first appeared in SCOP 1.57, called d1jgyl1
  
• d1jgyl_ appears in SCOPe 2.04
  
• d1jgyl_ appears in SCOPe 2.06
  
• d1jgyl_ appears in the current release, SCOPe 2.08